DPCfam | MC483242
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 185 ± 22 aa |
| Residues in low-complexity regions (%) | 2.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.92 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF12397 |
| Sequences matching dominant architecture (%) | 96.23 |
| Average overlap percent | 63.68 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158Q940 | 222-401 | 180 | PFESLVAKCYSANHSLLSMICQNIEEAIMLVGEDYVERNLSHYFALYAKLEIYLVSDSSKINDSLISKILPFLATSLKSKLMSLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9H583-F1 | 189-361 | 98.84 | 84.11 | View in AlphaFoldDB ↗ |