DPCfam | MC483107
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 250 ± 18 aa |
| Residues in low-complexity regions (%) | 3.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.06 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007F03F57 | 18-296 | 279 | KNLRIKNFPNYIFFCGGEIENDGENNNYISLRNVILKRLSQENKALHDNIILAEKFKDWLEDANIDNLIDFEILLAGLASSVILI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FDH7-F1 | 25-274 | 98.79 | 93.38 | View in AlphaFoldDB ↗ |