DPCfam | MC482793
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 254 ± 45 aa |
| Residues in low-complexity regions (%) | 3.19 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 24.96 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12423 |
| Sequences matching dominant architecture (%) | 58.54 |
| Average overlap percent | 17.47 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4TR57 | 416-801 | 386 | MAETVLSNAVVVKEVNVISKELDKEVTYNFTIAAGGSLAAPVSALDTIAGLDEFGDVADPVLASATQPSVGVKVVDKAHNAIYVW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B0S7L9-F1 | 940-1199 | 71.37 | 59.88 | View in AlphaFoldDB ↗ |