DPCfam | MC482704
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 397 ± 27 aa |
| Residues in low-complexity regions (%) | 2.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.75 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08279 |
| Sequences matching dominant architecture (%) | 6.11 |
| Average overlap percent | 11.34 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5U0Z1 | 70-431 | 362 | NSITVPCFAFDDFAADLSPVLYGLLVKDRAFDFSKVSIDVLPSSGNDKGYDAFFPENQKPYYLDDGFSDILVLDDTNYCLLMNKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5ULV0-F1 | 6-108 | 25.81 | 98.03 | View in AlphaFoldDB ↗ |