DPCfam | MC48258
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 481 ± 65 aa |
| Residues in low-complexity regions (%) | 3.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.58 |
| Average transmembrane regions | 0.32 |
| Dominant Pfam architecture(s) | PF10220 |
| Sequences matching dominant architecture (%) | 61.96 |
| Average overlap percent | 64.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A168LKG4 | 29-634 | 606 | ILGSTSDGTHYSPSAIANTIVKKDVFVSRNQSGTLMLADDLQFYIDADSAIGYLFMDAQVPMDVVTSTLFATTADSNSDTKSKNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FBA3-F1 | 28-569 | 99.80 | 83.03 | View in AlphaFoldDB ↗ |