DPCfam | MC482444
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 445 ± 54 aa |
| Residues in low-complexity regions (%) | 1.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05709 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 92.3 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S5DPW8 | 30-539 | 510 | PEISENVQDVPGMMGKIFQGNSYGQRVFEIDATIKATSEADRVDKIQRLSNLITITGDGEYPMVFSDDAEYTYYGHFSQISQVSR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FWU4-F1 | 37-495 | 99.78 | 93.86 | View in AlphaFoldDB ↗ |