DPCfam | MC48239
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 403 ± 47 aa |
| Residues in low-complexity regions (%) | 2.22 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 24.68 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03136 |
| Sequences matching dominant architecture (%) | 95.96 |
| Average overlap percent | 89.13 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A095WPL7 | 52-480 | 429 | VRWDYTAEDPLNDLRGMRLTRAAADPSMLTDDPYHLAPSGGSETLPLPRRSQGYLPAAVSSVLTNGARLYVDHAHPEYSAPETTN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0LU48-F1 | 76-458 | 95.70 | 97.54 | View in AlphaFoldDB ↗ |