DPCfam | MC481834
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Residues in low-complexity regions (%) | 2.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4HWV3 | 4-91 | 88 | IKRSEMRQIDQVLGMESGYVLDFSNRTFSEFFEDEFGISIYDDKYQVSGASKANLLRGFIEVEDGYLVGQALRKLYAHRSRTAVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132Z3K6-F1 | 6-81 | 85.56 | 92.46 | View in AlphaFoldDB ↗ |