DPCfam | MC48171
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Residues in low-complexity regions (%) | 2.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.83 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF05041 |
| Sequences matching dominant architecture (%) | 34.19 |
| Average overlap percent | 3.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7RPM6 | 1423-1593 | 171 | VRGLEFRGTYCHQREAEAISEDWADGGGCCCCTLGSIPGLLSYNNAWALRWLAWEVTSSKYVIDGYSITDNSAVNLLQVHELRRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G4RT15-F1 | 1438-1607 | 97.13 | 80.88 | View in AlphaFoldDB ↗ |