DPCfam | MC481696
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 316 ± 35 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.2 |
| Average transmembrane regions | 0.31 |
| Dominant Pfam architecture(s) | PF05359 |
| Sequences matching dominant architecture (%) | 9.38 |
| Average overlap percent | 13.15 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E5UFY9 | 243-504 | 262 | ISSQKMKFKDIVLKKNKISLSEVRFSEPHLTVYSSENQNKNKNKPFIYIVELQNVFFENGKANIIKNGQNKFSVDNVNAHFEQLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I0D4-F1 | 12-177 | 51.66 | 90.53 | View in AlphaFoldDB ↗ |