DPCfam | MC481493
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 169 ± 24 aa |
| Residues in low-complexity regions (%) | 7.32 |
| Residues in coiled-coil regions (%) | 9.31 |
| Predicted disordered residues (%) | 33.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0KQK0 | 18-168 | 151 | CGARCRDGLPCSNPPMNAATRCRMHGGASPQAKTAAVRRQTEADVQKLLADLDVTPVGDPLAALLKLGGQVLAWQEATARLVNEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8H2Y0-F1 | 431-459 | 16.20 | 53.96 | View in AlphaFoldDB ↗ |