DPCfam | MC48148
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 190 ± 55 aa |
| Residues in low-complexity regions (%) | 15.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 73.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08648 |
| Sequences matching dominant architecture (%) | 1.41 |
| Average overlap percent | 15.0 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S6XFS0 | 12-165 | 154 | ALAATMGFASFGATTEKKSNKRRRLDEGTSVAPHAPGTGANEVPVRVRQTAAVENQPKPKTQADLAKGGLAAFLGYGKDLPVPTA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PPD5-F1 | 12-346 | 99.51 | 62.16 | View in AlphaFoldDB ↗ |