DPCfam | MC481348
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 686 ± 111 aa |
| Residues in low-complexity regions (%) | 4.15 |
| Residues in coiled-coil regions (%) | 1.47 |
| Predicted disordered residues (%) | 20.79 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008142A8B | 108-727 | 620 | ALAADIPLKVIKHPQGVKSSSAGEDAPVQTHGESVGSRTGRESKTKCSPLTGFELFEVFAKKRHLGELQFYHLKASEDGPYRPYD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4CP76-F1 | 192-455 | 35.12 | 84.11 | View in AlphaFoldDB ↗ |