DPCfam | MC48116
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 162 ± 20 aa |
| Residues in low-complexity regions (%) | 1.7 |
| Residues in coiled-coil regions (%) | 0.69 |
| Predicted disordered residues (%) | 20.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11968 |
| Sequences matching dominant architecture (%) | 53.33 |
| Average overlap percent | 20.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005CF8C81 | 21-183 | 163 | EKQKQLANFIKKLHAELRSEYEILGIDEAWKIHVTKSEQLKTYAEFMYELANKYWTYESKNTSVTYCRIEWIKQQCKDYFFNGKM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P410-F1 | 31-193 | 99.39 | 84.58 | View in AlphaFoldDB ↗ |