DPCfam | MC481077
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 181 ± 14 aa |
| Residues in low-complexity regions (%) | 10.02 |
| Residues in coiled-coil regions (%) | 0.39 |
| Predicted disordered residues (%) | 2.6 |
| Average transmembrane regions | 4.37 |
| Dominant Pfam architecture(s) | PF12794 |
| Sequences matching dominant architecture (%) | 98.31 |
| Average overlap percent | 54.57 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A0DJW2 | 628-810 | 183 | REKGVAQVHFQWQNPSRLTLQKQIFWIRPLWVPLIFVIATIEAANKMAYGNSLGRLAFMIVITAAIVFAAKMLQIGRGKSKDPQD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GLB4-F1 | 561-738 | 99.45 | 86.79 | View in AlphaFoldDB ↗ |