DPCfam | MC48087
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 116 ± 19 aa |
| Residues in low-complexity regions (%) | 10.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.64 |
| Average transmembrane regions | 0.82 |
| Dominant Pfam architecture(s) | PF00194 |
| Sequences matching dominant architecture (%) | 3.03 |
| Average overlap percent | 25.82 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006D91439 | 738-862 | 125 | VLSQTTQPVFNEASNSSHESRIGAAEGLETERKTLIPLVIVSALTFICLVVLIAILIYWRKCFQTAHFYLEDNTSPRVISTLAAP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q62656-F1 | 1610-1724 | 97.46 | 59.60 | View in AlphaFoldDB ↗ |