DPCfam | MC480839
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Residues in low-complexity regions (%) | 3.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.13 |
| Average transmembrane regions | 0.96 |
| Dominant Pfam architecture(s) | PF08172 |
| Sequences matching dominant architecture (%) | 99.32 |
| Average overlap percent | 36.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E7EXN5 | 704-780 | 77 | EALEQRYEASVDPFRQFSKGERQRKLKEMTPVERTVFVVAKAMLGTKEMRTFLFFYVLAMHLLVFSTTYHWSHNESG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M8J7-F1 | 79-158 | 97.56 | 85.57 | View in AlphaFoldDB ↗ |