DPCfam | MC480626
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 170 ± 15 aa |
| Residues in low-complexity regions (%) | 5.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.59 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF12422 |
| Sequences matching dominant architecture (%) | 2.56 |
| Average overlap percent | 6.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A087UW56 | 58-228 | 171 | LLSVMKNEDYEKLVDLASKNKSKKIPYTFKDAIKNLSGSEIDKMWSMLNKMVEKKAEVLLDGNKDTSNTSLDNKTCTELNQVLHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6DFV1-F1 | 4-179 | 99.42 | 84.13 | View in AlphaFoldDB ↗ |