DPCfam | MC480567
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Residues in low-complexity regions (%) | 3.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13638 |
| Sequences matching dominant architecture (%) | 10.92 |
| Average overlap percent | 61.45 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q2MI54 | 150-220 | 71 | VLDSSVIIDGRISELVDTKVFDAPFIVPRFILNELQLLSDSADKLKRARGRRGLDLLAKLQANPNVEVTMD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q06754-F1 | 166-239 | 97.37 | 92.76 | View in AlphaFoldDB ↗ |