DPCfam | MC480453
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 119 ± 26 aa |
| Residues in low-complexity regions (%) | 9.63 |
| Residues in coiled-coil regions (%) | 59.78 |
| Predicted disordered residues (%) | 38.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17098 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 46.89 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A087X1R4 | 1-155 | 155 | MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZPY0-F1 | 9-151 | 100.00 | 88.81 | View in AlphaFoldDB ↗ |