DPCfam | MC480444
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 215 ± 33 aa |
| Residues in low-complexity regions (%) | 1.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.88 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10223 |
| Sequences matching dominant architecture (%) | 92.31 |
| Average overlap percent | 92.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067BYJ8 | 44-245 | 202 | RVHWAHAVNSQAQLTDALARGLALEADVQLSPENVLIMAHPPANTSDLTFEMFLARASASNCIVKLDFKTRAAFEAALSNLTAAP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5RDY9-F1 | 71-299 | 100.00 | 95.55 | View in AlphaFoldDB ↗ |