DPCfam | MC480124
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Residues in low-complexity regions (%) | 9.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.55 |
| Average transmembrane regions | 1.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4GJF1 | 376-576 | 201 | VFVHAKVFFSIGGRQFGGEPVQFSYMPDLVLDHARDVTIKLHHRLGRYLQLHLYFAARWMMLSEITFISVPVVGNFTDEGLLNGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59DZ7-F1 | 371-534 | 97.39 | 70.78 | View in AlphaFoldDB ↗ |