DPCfam | MC479741
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 127 ± 30 aa |
| Residues in low-complexity regions (%) | 6.43 |
| Residues in coiled-coil regions (%) | 1.26 |
| Predicted disordered residues (%) | 2.32 |
| Average transmembrane regions | 3.59 |
| Dominant Pfam architecture(s) | PF09801 |
| Sequences matching dominant architecture (%) | 95.24 |
| Average overlap percent | 87.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4NCB3 | 861-979 | 119 | AIILMLFTALVAGISFTLDVVFGWDAVRGDTTQGWLCGFVLVLDGGFCMAIAIILLVSRSKLVPDFAVTIHALHLVITTLYTGRV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9SSD6-F1 | 10-146 | 98.57 | 92.97 | View in AlphaFoldDB ↗ |