DPCfam | MC479481
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Residues in low-complexity regions (%) | 0.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.64 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF15629- PF15628 |
| Sequences matching dominant architecture (%) | 92.0 |
| Average overlap percent | 25.0 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M5W8B9 | 851-925 | 75 | LLAGFETREHDDPSPYLLAIWTSDQISNSSQSPQKKCNSQESGELYNGEMTCFSHRRLPEQASDTIHGTILIPCR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LZV9-F1 | 1779-1853 | 100.00 | 83.45 | View in AlphaFoldDB ↗ |