DPCfam | MC479343
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Residues in low-complexity regions (%) | 3.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.74 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF13570 |
| Sequences matching dominant architecture (%) | 7.79 |
| Average overlap percent | 53.94 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X0T3S2 | 49-155 | 107 | SPKGIGFTRKNPPLWHQWIPLRVRAMVAADNVLFIAGPPDVLEPGDPMASFDGRKGGELWAVSKHTGENISKDQLDSPPVFDGMS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E4PKG3-F1 | 78-128 | 50.49 | 95.98 | View in AlphaFoldDB ↗ |