DPCfam | MC479269
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1281 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 19.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01329 |
| Sequences matching dominant architecture (%) | 97.76 |
| Average overlap percent | 90.88 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A063Y4T1 | 16-106 | 91 | LNAEQIQQELTVLPGWQLLNEQGEEKLSRQFSFKDFASALAFTNQIGAFAESIGHHPDLLTRWGSVTVTWYTHKIGGVQQGDFLC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B9L1Y8-F1 | 9-92 | 97.67 | 97.38 | View in AlphaFoldDB ↗ |