DPCfam | MC479250
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 557 ± 53 aa |
| Residues in low-complexity regions (%) | 2.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13401 |
| Sequences matching dominant architecture (%) | 3.9 |
| Average overlap percent | 16.03 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U1KW86 | 17-629 | 613 | IQSEAERLSDKLLVAVHHPTKLISTDYGTQTPEVRTQQDLLERLLHTNDIIPLLGESGSGKSHLIRWLHAVANTHPKAIEENWHI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3CWU4-F1 | 100-225 | 22.10 | 95.68 | View in AlphaFoldDB ↗ |