DPCfam | MC47917
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 3.13 |
| Residues in coiled-coil regions (%) | 23.11 |
| Predicted disordered residues (%) | 28.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A154P549 | 4307-4387 | 81 | AMLDQIRNPCPCFKEIIYTHFWIKRHEIVAQLEGWIRDMEMHGSDRRFGRTLSLNALALRTHYRLLREELNKLPTPEGLED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5S6P7J0-F1 | 857-934 | 100.00 | 92.91 | View in AlphaFoldDB ↗ |