DPCfam | MC479118
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 771 |
|---|---|
| Mean domain length (aa) | 266 ± 51 aa |
| Residues in low-complexity regions (%) | 9.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.9 |
| Average transmembrane regions | 7.61 |
| Dominant Pfam architecture(s) | PF03116 |
| Sequences matching dominant architecture (%) | 84.01 |
| Average overlap percent | 87.72 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A101WPV6 | 15-298 | 284 | DDNIPKIMYKVVLALVPAALAGIIFFGIRAALIYTVSILTSVITEYLFMKIRKKPIAINDGSAAVTGLLLALTLPPYLPLWMAAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-H6LC31-F1 | 31-301 | 100.00 | 86.97 | View in AlphaFoldDB ↗ |