DPCfam | MC479017
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Residues in low-complexity regions (%) | 3.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.94 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF00287 |
| Sequences matching dominant architecture (%) | 99.53 |
| Average overlap percent | 43.97 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K2TV87 | 24-123 | 100 | PVERHGLEAIRWFLYDPEKGAIMGRTPMSWLKIIVFYIIYYIFLSVFWLLMLFVFFFTIDNHSPKWQNANGIIGKSPGLGLRPYQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M9PDX8-F1 | 19-114 | 98.94 | 90.38 | View in AlphaFoldDB ↗ |