DPCfam | MC478911
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Residues in low-complexity regions (%) | 4.28 |
| Residues in coiled-coil regions (%) | 0.23 |
| Predicted disordered residues (%) | 5.33 |
| Average transmembrane regions | 0.34 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C3JR38 | 1-65 | 65 | MTVGSKILEELRDPMSVSALWERFSIHEHSSHRAQRITFDWFTLALAALYTMRLVDTSDEGFLRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q45599-F1 | 56-125 | 91.67 | 87.47 | View in AlphaFoldDB ↗ |