DPCfam | MC478793
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Residues in low-complexity regions (%) | 3.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.81 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00568 |
| Sequences matching dominant architecture (%) | 87.76 |
| Average overlap percent | 25.69 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3SMF5 | 104-170 | 67 | PTFHQWRDARQVYGLNFASKEEATTFSTAMMFALNVLSSQDGGGTLSSVAVTCPAVQHKNGPSSEDP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3C2P8-F1 | 86-149 | 90.67 | 74.89 | View in AlphaFoldDB ↗ |