DPCfam | MC478610
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Residues in low-complexity regions (%) | 1.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.78 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF01094 |
| Sequences matching dominant architecture (%) | 87.34 |
| Average overlap percent | 25.73 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A016V2L4 | 709-787 | 79 | LDSAKERRDFLIRTSQMGMSTDEFVYVFMGMRGFAFGQSGAGKEVLPNGLTPIWEDVTNGNADRMDDVAKEAAKRVLLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q19768-F1 | 189-265 | 95.24 | 86.25 | View in AlphaFoldDB ↗ |