DPCfam | MC478542
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 561 |
|---|---|
| Mean domain length (aa) | 154 ± 30 aa |
| Residues in low-complexity regions (%) | 0.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16656 |
| Sequences matching dominant architecture (%) | 0.19 |
| Average overlap percent | 5.98 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F6MQG8 | 26-154 | 129 | QTCPSLEAGDLFKVSESSAVYLVSSDMKRLYFPTSEVFHTWYADFSSVQVISSVCVDNYPAPTNAPFGVNHRPGSRLVKLQISPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42092-F1 | 290-409 | 84.73 | 93.83 | View in AlphaFoldDB ↗ |