DPCfam | MC477995
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Residues in low-complexity regions (%) | 21.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.49 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09805 |
| Sequences matching dominant architecture (%) | 96.71 |
| Average overlap percent | 78.25 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| O14012 | 3-149 | 147 | NTSLLTRGGEIYSRKKGKKQRLEEIVFDKEKRKEYLTGFHKRKVERRKHAQVQLEQQKREERLALRKSLREQRKRELAERLAFSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W0Q6-F1 | 17-148 | 97.58 | 81.87 | View in AlphaFoldDB ↗ |