DPCfam | MC477971
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 82 ± 17 aa |
| Residues in low-complexity regions (%) | 0.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13738 |
| Sequences matching dominant architecture (%) | 14.29 |
| Average overlap percent | 18.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00083C4647 | 1-63 | 63 | MDPQILTLSLGSWMSLPGLRYEPRDGSEKRASAKHVAEYYVRYVQEMGLQENFENGVIVTRIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QMX7-F1 | 131-202 | 93.75 | 86.76 | View in AlphaFoldDB ↗ |