DPCfam | MC477945
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 88 ± 15 aa |
| Residues in low-complexity regions (%) | 0.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.82 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF09331 |
| Sequences matching dominant architecture (%) | 0.88 |
| Average overlap percent | 1.79 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M1DSB6 | 7-89 | 83 | YRIDGMPLAMQVWIYECCSAVDLNIAEKKTNRIPKLVNWRTRNSRIHYEFLMEGMFGDNSNPLKYKNIQPSLKEIAFYQLPSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9ZV75-F1 | 113-166 | 50.98 | 78.74 | View in AlphaFoldDB ↗ |