DPCfam | MC477891
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 230 ± 26 aa |
| Residues in low-complexity regions (%) | 25.02 |
| Residues in coiled-coil regions (%) | 3.91 |
| Predicted disordered residues (%) | 28.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M2X3B1 | 30-249 | 220 | PHDRWLRAVARGGQGRYAAARAELARLRSAGGGAVLDSLAASTEASLLRQLGWHRIASGHDGRALAVLGAAQTVAARIARCDALT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EI18-F1 | 39-258 | 96.98 | 93.50 | View in AlphaFoldDB ↗ |