DPCfam | MC477882
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 112 ± 20 aa |
| Residues in low-complexity regions (%) | 2.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A072PJB9 | 162-277 | 116 | CLTQSTLQLTLSDNNLYDALNRTGYIASNYQFQFDGPPQSGALYTSGWSVCPVVSADPDADIGTPPAATTDSGLMALALGNSTTF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6ZQH4-F1 | 129-223 | 79.13 | 94.99 | View in AlphaFoldDB ↗ |