DPCfam | MC477198
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13337 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 25.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P6YXI8 | 402-468 | 67 | GPGLTSRDVRAINKTLSGLLKLMYPHGEVSDDQLEELVSLAIEGRQRIRNQLHLMAPGEYAPVQISA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0DUG1-F1 | 403-481 | 98.75 | 93.12 | View in AlphaFoldDB ↗ |