DPCfam | MC477127
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Residues in low-complexity regions (%) | 0.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14436 |
| Sequences matching dominant architecture (%) | 97.16 |
| Average overlap percent | 93.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A173VZ82 | 63-187 | 125 | NFMDSTIEHIFEGNVRRGKAGGYHYECIKDTAGNIVNGTEVLINDLGVYKAQVEVNGIPKSGNGGYSTFFPKEKSPQDVIDSINE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q813X6-F1 | 423-543 | 96.83 | 89.56 | View in AlphaFoldDB ↗ |