DPCfam | MC476863
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 178 ± 30 aa |
| Residues in low-complexity regions (%) | 26.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 61.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02181 |
| Sequences matching dominant architecture (%) | 92.31 |
| Average overlap percent | 14.37 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B0AKY6 | 19-210 | 192 | KLEPKKSENDLQWEELVRNMSRPLHLCDLDFTDLTSEDEKDILAPRGNGHGVPPPPPPLAGATLPPPMLPTHFGYPPSVNYANMS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E1JI78-F1 | 1892-2078 | 100.00 | 57.04 | View in AlphaFoldDB ↗ |