DPCfam | MC476710
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 240 ± 35 aa |
| Residues in low-complexity regions (%) | 2.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.03 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF02310 |
| Sequences matching dominant architecture (%) | 12.05 |
| Average overlap percent | 30.49 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5X329 | 5-219 | 215 | LISPPVSNFGQAAPALSVLTSFLRSKGWHACQWDLGIEAFHHFYCEQTLRRSYQLLVAKDAEEVLLDLGQRVVSEIERAKETLRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O58549-F1 | 58-135 | 31.37 | 98.01 | View in AlphaFoldDB ↗ |