DPCfam | MC476581
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Residues in low-complexity regions (%) | 1.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00340 |
| Sequences matching dominant architecture (%) | 84.21 |
| Average overlap percent | 29.23 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L9JLY3 | 46-126 | 81 | IQDSSHRVWVLQGKTLTAVPRKQHTVPVTITLIPCKNLETLEKDRGNPIYLGLKEPELCLSCRKVGEQPMLQLMEQNIMDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UHA7-F1 | 8-94 | 100.00 | 94.74 | View in AlphaFoldDB ↗ |