DPCfam | MC475017
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 139 ± 10 aa |
| Residues in low-complexity regions (%) | 2.93 |
| Residues in coiled-coil regions (%) | 1.0 |
| Predicted disordered residues (%) | 18.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00217 |
| Sequences matching dominant architecture (%) | 97.06 |
| Average overlap percent | 15.7 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R5LWR8 | 197-341 | 145 | VRGVYGRPGENPGDLYEVTNQKTLGLSEKEILELVENVAVQLTDQENQVRKLSLEKHRLMREDEAYKSYGVLRYARRMAEKDGLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A8F953-F1 | 206-349 | 99.31 | 92.00 | View in AlphaFoldDB ↗ |