DPCfam | MC474701
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Residues in low-complexity regions (%) | 27.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.67 |
| Average transmembrane regions | 0.41 |
| Dominant Pfam architecture(s) | PF11737 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 34.44 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A136QP68 | 7-81 | 75 | PPTTIIIEPADPQVVYVPSYNPTTSYGTWAYPASPPVYYPPPPMYYPGSALVAGLAFGTGVAIVASLWGDCDWGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZRS9-F1 | 209-281 | 92.50 | 84.58 | View in AlphaFoldDB ↗ |