DPCfam | MC474466
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Residues in low-complexity regions (%) | 5.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00249 |
| Sequences matching dominant architecture (%) | 2.94 |
| Average overlap percent | 1.23 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00097DB108 | 452-574 | 123 | GSIFNRGAAGLQAKIHLINTLYNMHVEDVADIDWDQVAQDVGNVTPVCVQKSFHRLKVSRVPNWTSLSYGDIIDFLYQRELPDLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A1Z7-F1 | 715-843 | 98.46 | 83.67 | View in AlphaFoldDB ↗ |