DPCfam | MC47399
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.38 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF07217 |
| Sequences matching dominant architecture (%) | 94.02 |
| Average overlap percent | 31.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A066WGB7 | 11-148 | 138 | LLAILAVVALSSLQQAAAFGAGNIPSWAYLEGKAFRHGDLEDVLAEIAKKSGGLLGRGSKFTGLDIKRVYFGNWLRDYSQAMDVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CMW3-F1 | 16-135 | 96.83 | 88.25 | View in AlphaFoldDB ↗ |