DPCfam | MC473865
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 130 ± 17 aa |
| Residues in low-complexity regions (%) | 1.77 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 17.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00271 |
| Sequences matching dominant architecture (%) | 95.94 |
| Average overlap percent | 17.58 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004159DC1 | 606-725 | 120 | EETVDVPEVDTVLLLWPTDNPARFLRQLGVGLRRAPGKAALTVLDFIGTQRQEFRFDLRYRALTGASRRALRRQVEQGFPALPSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FVC3-F1 | 510-646 | 99.26 | 85.67 | View in AlphaFoldDB ↗ |