DPCfam | MC473625
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Residues in low-complexity regions (%) | 2.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10004 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 95.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I0FAS5 | 2-132 | 131 | NYAVEYLMNHPGVQQEEILKLAWGDKDDIEEAILNILRVEENSFYAIEKRKWRYVILLEVKSKYSDHAIELLSKLAEVYADMNYP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F606-F1 | 6-151 | 96.75 | 93.49 | View in AlphaFoldDB ↗ |